Protein Info for Dsui_3207 in Dechlorosoma suillum PS

Annotation: ankyrin repeat-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF12796: Ank_2" amino acids 34 to 100 (67 residues), 32 bits, see alignment E=3.9e-11 amino acids 43 to 131 (89 residues), 50.5 bits, see alignment E=6.4e-17 PF13857: Ank_5" amino acids 69 to 110 (42 residues), 39.8 bits, see alignment E=1.1e-13 amino acids 89 to 138 (50 residues), 34.4 bits, see alignment E=5.5e-12 PF00023: Ank" amino acids 70 to 100 (31 residues), 34 bits, see alignment 5.9e-12 amino acids 103 to 133 (31 residues), 28 bits, see alignment 4.8e-10 PF13606: Ank_3" amino acids 70 to 98 (29 residues), 22.8 bits, see alignment 2.2e-08 PF13637: Ank_4" amino acids 74 to 112 (39 residues), 28.9 bits, see alignment 2.8e-10

Best Hits

KEGG orthology group: None (inferred from 58% identity to dar:Daro_1183)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIS9 at UniProt or InterPro

Protein Sequence (170 amino acids)

>Dsui_3207 ankyrin repeat-containing protein (Dechlorosoma suillum PS)
MPYALRSLIGLCIGVVFSLFLSVFLAPHAHAQSLSPDQPVHDVARLGTAAEMQALLKRQP
GLKDARTDMGSTPLHLAATNPDSGVVKALLAAGADVNARDGEGATPLHLAAYADKSANAT
LLLQAGADVNAVTSNGRTVTSMGRKTMANEAVGIISLWMLKGCKPGKAGC