Protein Info for Dsui_3204 in Dechlorosoma suillum PS

Annotation: chorismate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 PF01264: Chorismate_synt" amino acids 10 to 345 (336 residues), 460.6 bits, see alignment E=1.1e-142 TIGR00033: chorismate synthase" amino acids 10 to 350 (341 residues), 461.3 bits, see alignment E=9.5e-143

Best Hits

Swiss-Prot: 92% identical to AROC_DECAR: Chorismate synthase (aroC) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K01736, chorismate synthase [EC: 4.2.3.5] (inferred from 92% identity to dar:Daro_0858)

MetaCyc: 65% identical to chorismate synthase (Escherichia coli K-12 substr. MG1655)
Chorismate synthase. [EC: 4.2.3.5]

Predicted SEED Role

"Chorismate synthase (EC 4.2.3.5)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 4.2.3.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIS6 at UniProt or InterPro

Protein Sequence (368 amino acids)

>Dsui_3204 chorismate synthase (Dechlorosoma suillum PS)
MSGNTFGTLFTVTSFGESHGPAIGCVVDGCPPGLELTEADIQAELDRRKPGTSRHVTQRR
EPDTVEILSGVFEGKTTGTPIGLLIRNQDQRSKDYGNIASTFRPGHADYGYTQKYGFRDY
RGGGRSSARETAVRVAAGAIARKWLQQRYGISIRGWMSQLGPIEIPFVDAAAIDGNAFFA
PNAAIVPELEAYMDALRKSLDSVGAKITVTATGVPPGWGEPVYDRLDAEIAYAMMGINAV
KGVEIGAGFASIAQKGSEHGDEMTPAGFLSNHAGGVLGGISTGQDIVVNMAIKPTSSIAQ
PRRSVDVQGNAVEVATEGRHDPCVGIRATPIAEAMLALVLMDHALRHRAQCGDVVCATPR
LPAAPGRG