Protein Info for Dsui_3195 in Dechlorosoma suillum PS

Annotation: Cobalt transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 58 to 77 (20 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 115 to 132 (18 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details PF02361: CbiQ" amino acids 11 to 128 (118 residues), 29.3 bits, see alignment E=3.4e-11

Best Hits

KEGG orthology group: None (inferred from 40% identity to azo:azo1044)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIR7 at UniProt or InterPro

Protein Sequence (209 amino acids)

>Dsui_3195 Cobalt transport protein (Dechlorosoma suillum PS)
MPAPPSARHPAVRLLLCLLLALAAQVLPALLAAALVLPLLRADGVAGRCRTLLRRTRWLL
LSLFLVFALGTPGTPLYDHAWSPSREGVFLGLEQCLRLATVLLAVSWLLHSTRPAALAQG
LLTLLQPLRYLGLAPERGIARLLLVMRHVDSAEAWPRGQDWRRFLEMPAQEQESVLEVEL
HPLPGPDRLLLAGMGLGILVLLASPLWLP