Protein Info for Dsui_3177 in Dechlorosoma suillum PS

Annotation: ABC-type antimicrobial peptide transport system, ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 PF00005: ABC_tran" amino acids 31 to 179 (149 residues), 108.4 bits, see alignment E=4.4e-35

Best Hits

Swiss-Prot: 48% identical to LOLD_BORBR: Lipoprotein-releasing system ATP-binding protein LolD (lolD) from Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)

KEGG orthology group: K02003, (no description) (inferred from 81% identity to dar:Daro_3917)

MetaCyc: 44% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"Macrolide export ATP-binding/permease protein MacB (EC 3.6.3.-)" in subsystem Multidrug Resistance Efflux Pumps (EC 3.6.3.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIP9 at UniProt or InterPro

Protein Sequence (242 amino acids)

>Dsui_3177 ABC-type antimicrobial peptide transport system, ATPase component (Dechlorosoma suillum PS)
MSSGNGAAPPLIQFRRITKTYGQGQAEFQALRGVDLEIAEGDFVAVMGPSGSGKSTVMNI
LGCLDSPSSGDYLFQGVPVQDLSRNQRALLRRHYLGFVFQGFNLLARTSAQENVELPLLY
RGESPEARHRASREALARVGLNGWEHHTPAELSGGQQQRVAIARAIVTNPLVLLADEPTG
NLDSQRSHEIMELLVRLNREQGITIAMVTHEPDMAAYASRIVHFVDGRVASDERTAEPAP
CS