Protein Info for Dsui_3171 in Dechlorosoma suillum PS

Annotation: putative protein-disulfide isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 PF01323: DSBA" amino acids 10 to 189 (180 residues), 44.8 bits, see alignment E=6.3e-16

Best Hits

KEGG orthology group: K07396, putative protein-disulfide isomerase (inferred from 62% identity to pba:PSEBR_a311)

Predicted SEED Role

"Thioredoxin-like protein clustered with PA0057" in subsystem PA0057 cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIP3 at UniProt or InterPro

Protein Sequence (218 amino acids)

>Dsui_3171 putative protein-disulfide isomerase (Dechlorosoma suillum PS)
MTAPILHYLYDPLCGWCYGAAPLVRAARDVLPVRPRSGGMMAGARRQAVTPQLRAYVQPH
DQRIAQLSGQPFGPAYTDGLLRDNGAVFDSEPPTAAMLAAEQLAGRGLDMLARLQVAHYE
EGRRIAEPSVLVELAASLGLDAAAFAETLTQLSGEAVQAHFRDTREFMARVGAQGFPTFV
LETAEGLQSIDVSAYLGHPQAFQERLRQRAGPPAGSAD