Protein Info for Dsui_3159 in Dechlorosoma suillum PS

Annotation: PAS domain S-box

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 662 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details amino acids 262 to 282 (21 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 299 to 422 (124 residues), 82.1 bits, see alignment E=1.8e-27 PF00989: PAS" amino acids 302 to 411 (110 residues), 57.7 bits, see alignment E=3.9e-19 PF13188: PAS_8" amino acids 302 to 356 (55 residues), 30 bits, see alignment 1.2e-10 PF13426: PAS_9" amino acids 311 to 416 (106 residues), 49.5 bits, see alignment E=1.5e-16 PF08448: PAS_4" amino acids 318 to 418 (101 residues), 49.3 bits, see alignment E=1.9e-16 PF08447: PAS_3" amino acids 324 to 409 (86 residues), 31 bits, see alignment E=8.5e-11 PF00512: HisKA" amino acids 440 to 508 (69 residues), 34.9 bits, see alignment E=4.6e-12 PF02518: HATPase_c" amino acids 552 to 659 (108 residues), 87.6 bits, see alignment E=2.7e-28

Best Hits

KEGG orthology group: K11711, two-component system, LuxR family, sensor histidine kinase DctS [EC: 2.7.13.3] (inferred from 51% identity to dar:Daro_2995)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIN1 at UniProt or InterPro

Protein Sequence (662 amino acids)

>Dsui_3159 PAS domain S-box (Dechlorosoma suillum PS)
MKRLSVPSSGSVLQWPRWTLLMPKLAVGLLVISLVSLLWLLHRNEVEEQRATLIADILWL
EQNFRFHMSGNEDQLNRTGLDMGSAAKGGTPATVFQVQAQHIVKNNPEVEQVIWLDAGGN
LVQAYPNRIPDRQELDIFGGPITRDAFDFARKLGKATYTDPYRAAGGNSQIDLFVPIYRQ
GDFAGMLVMAYSLKSMLNHLVPWWFAEKYQLRILDDSGAILASKSNIQGEPGLAYELPFD
PPGHGLMLQGIAYRNAGNPAQLVLAGAIVVLAIGVFWSLFAIRGLIKKRLAAEQALRDEH
AFRQAMEDSMIIGMRARDMDGRITYVNPAFCRMSGYRADELVGHSPPLPYWNPDSLDTHE
EQNALVLTGHAPNEGFEASIRHRDGHIVHTMVYATPLIDAHGKQTGWISSVVDISERKKA
QALQRQQQEKLEQTARLVTMGEMASTLAHELNQPLSAIASYTTGCLNRLEAGDYTREEIS
GALNKLALQAQRAGRIIRRVHDFVRRREPQRVICHLEEVIEDSIAFIEPLARKQQVHMLR
LVPAHLPKLLADPVLLGQVLINLMRNGIDAMAATPPERRQLIVEAQLLGDQVEVCIADRG
CGIPPEVAEKLFSPFFTTKTEGMGMGLNICRSVIEFHGGRLWFEPGAEGGTVFIFTLPLD
WE