Protein Info for Dsui_3156 in Dechlorosoma suillum PS

Annotation: putative permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 49 to 67 (19 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 104 to 120 (17 residues), see Phobius details amino acids 141 to 164 (24 residues), see Phobius details amino acids 201 to 223 (23 residues), see Phobius details amino acids 235 to 256 (22 residues), see Phobius details PF01925: TauE" amino acids 16 to 247 (232 residues), 73.7 bits, see alignment E=9.3e-25

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 44% identity to din:Selin_2398)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QI85 at UniProt or InterPro

Protein Sequence (257 amino acids)

>Dsui_3156 putative permease (Dechlorosoma suillum PS)
MPHDLLSPPLLLACIALIVGIAAFAHGVIGVGFPLITTPCIALLTDLKTAVLITVLPNIL
LNILSILRGGNWRNSLLKHWRLAAYVLLGSLVGTQLLIGLPAEPLKLALALMMLVSINLN
RLKKLDWSFLRRHRRTSEAAFGLIGGILSGTVNVSVPPLAIYFIGLDLSPVATVQLFNLC
FIVGKLTQAGTLAAHGEFTAAILWQSAGLTVLAVACLIPGMRIQSRMDATTYRRWLNHTL
LLMAVLMLVQVGLAWAR