Protein Info for Dsui_3155 in Dechlorosoma suillum PS

Annotation: tripartite ATP-independent periplasmic transporter solute receptor, DctP family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF03480: DctP" amino acids 29 to 312 (284 residues), 368.7 bits, see alignment E=1e-114 TIGR00787: TRAP transporter solute receptor, DctP family" amino acids 29 to 284 (256 residues), 342.1 bits, see alignment E=1e-106

Best Hits

Swiss-Prot: 68% identical to DCTP_RHOCA: C4-dicarboxylate-binding periplasmic protein DctP (dctP) from Rhodobacter capsulatus

KEGG orthology group: K11688, C4-dicarboxylate-binding protein DctP (inferred from 85% identity to app:CAP2UW1_2104)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, periplasmic component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QI84 at UniProt or InterPro

Protein Sequence (332 amino acids)

>Dsui_3155 tripartite ATP-independent periplasmic transporter solute receptor, DctP family (Dechlorosoma suillum PS)
MKMSHLMFGLLAGVLSCGAMAQQPIVIKFSHVVAVDTPKGMAADFFAKKAAELTKGKVKV
EVYPNSQLYKDKEEMEALQLGAVQMLAPSLAKFGPLGVREFEAFDLPYIFDNYEELHKVT
TGPVGAALLAKLEPKGIKGLAYWDNGFKSFSANTPIKTPADLKGKKMRIQSSKVLEEEMR
SLGALPQVMAFSEVYQALQTGVVDGTENPISNLYTQKMHEVQKHLTLTDHGYLGYAVIVN
KKFWDGLPADVRGQLETAMKDATTYANKIAKEQNDKDLESVKKSGKTQVYVPTKEEREAF
KKALTPVHAKMADRIGKDLIQSIYKETGFTAQ