Protein Info for Dsui_3148 in Dechlorosoma suillum PS

Annotation: flavin-dependent dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 PF07992: Pyr_redox_2" amino acids 8 to 173 (166 residues), 36.7 bits, see alignment E=1.5e-12 PF01494: FAD_binding_3" amino acids 8 to 325 (318 residues), 37.7 bits, see alignment E=6.6e-13 PF01134: GIDA" amino acids 9 to 167 (159 residues), 27.4 bits, see alignment E=8.2e-10 PF12831: FAD_oxidored" amino acids 9 to 162 (154 residues), 32 bits, see alignment E=4e-11 PF01266: DAO" amino acids 9 to 55 (47 residues), 28.8 bits, see alignment 4.1e-10 PF00890: FAD_binding_2" amino acids 9 to 44 (36 residues), 28.6 bits, see alignment 4e-10 PF13450: NAD_binding_8" amino acids 12 to 43 (32 residues), 28.3 bits, see alignment (E = 7.7e-10) PF26311: ETF-QO_FixC_C" amino acids 372 to 436 (65 residues), 88.6 bits, see alignment E=1.1e-28

Best Hits

Swiss-Prot: 61% identical to FIXC_BRADU: Protein FixC (fixC) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K00313, electron transfer flavoprotein-quinone oxidoreductase [EC: 1.5.5.-] (inferred from 68% identity to afe:Lferr_1194)

MetaCyc: 62% identical to quinone reductase (NADH,flavodoxin) complex electron transfer catalytic subunit (Azotobacter vinelandii)
1.19.1.M1 [EC: 1.19.1.M1]

Predicted SEED Role

"Probable electron transfer flavoprotein-quinone oxidoreductase FixC (EC 1.5.5.-)" in subsystem Acetyl-CoA fermentation to Butyrate (EC 1.5.5.-)

Isozymes

Compare fitness of predicted isozymes for: 1.5.5.-

Use Curated BLAST to search for 1.19.1.M1 or 1.5.5.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QI77 at UniProt or InterPro

Protein Sequence (436 amino acids)

>Dsui_3148 flavin-dependent dehydrogenase (Dechlorosoma suillum PS)
MTQNIEKFDVIVVGAGPAGNAAAYTLAKAGKKVLQLERGEYPGSKNVQGAILYADALEKI
IPDFRDSAPLERTVIEQRMWVMEDESYVGTTFRSDRFNQMPGNRYTIIRARFDKWFSEQV
QKAGALVICEMTVIALLRDAAGKVIGVEVDREDGKIYADTVILADGVNSLVASRAGLRED
IKPAAVALAVKETIFLPKETVEARFNLKGSEGVVIEMLGSISQGMAGTAFLYTNKDSISL
GIGCMLSDMKAQNTTPAELLEKLKQHPSVAPLIAGGETREYAAHLIPEGGYHALPELYGE
GWLLVGDSAGFVNAVHREGSNLAMTSGRLAAETLLELGEKGLPSTAANLARYKARLEDSI
VLKDLKKYRNIPDTLHSQRQFLSDYPALLNGAAHEFFTVDGQDKATKEKAIFNAFRERRS
LLGLLGDAYRLWRATR