Protein Info for Dsui_3144 in Dechlorosoma suillum PS

Annotation: type IV pilus biogenesis/stability protein PilW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR02521: type IV pilus biogenesis/stability protein PilW" amino acids 15 to 258 (244 residues), 219.4 bits, see alignment E=2.4e-69 PF13432: TPR_16" amino acids 61 to 123 (63 residues), 27.7 bits, see alignment E=1.5e-09 amino acids 141 to 190 (50 residues), 15.7 bits, see alignment 8.8e-06 PF13181: TPR_8" amino acids 89 to 121 (33 residues), 19.5 bits, see alignment 4.1e-07 amino acids 160 to 192 (33 residues), 15.8 bits, see alignment 6.3e-06 PF13176: TPR_7" amino acids 161 to 192 (32 residues), 16 bits, see alignment 5.1e-06

Best Hits

KEGG orthology group: K02656, type IV pilus assembly protein PilF (inferred from 55% identity to dar:Daro_2987)

Predicted SEED Role

"Type IV pilus biogenesis protein PilF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QI73 at UniProt or InterPro

Protein Sequence (272 amino acids)

>Dsui_3144 type IV pilus biogenesis/stability protein PilW (Dechlorosoma suillum PS)
MSKTPFRLPTLPLLMCCLAALVSACNSNPSVPSSQPLAEGPQSQMTVTGNARNSAKIHTE
LGALYFQDGQLATALEELRIAIAADSSYAPAHNVLGLVHMDLRENEAAEQSFRRALSLAG
NDPEINNNFGWFLCQVGREKESIAYFNNAIKNPLYPTPERAYLNAGRCSEKIGDLKGAEN
YYFRALRLARNDFQATLAMAGLKYRQDDLDESYRLVREFHKASDPTPESLWLGLRLARKL
GDRAEEASYNAQLRRRFPGSRETQALLKGNFE