Protein Info for Dsui_3134 in Dechlorosoma suillum PS

Annotation: membrane protease subunit, stomatin/prohibitin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF01145: Band_7" amino acids 25 to 205 (181 residues), 119.2 bits, see alignment E=1.1e-38 TIGR01932: HflC protein" amino acids 144 to 285 (142 residues), 171.5 bits, see alignment E=1e-54

Best Hits

Swiss-Prot: 46% identical to HFLC_HAEIN: Protein HflC (hflC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K04087, membrane protease subunit HflC [EC: 3.4.-.-] (inferred from 82% identity to dar:Daro_2977)

Predicted SEED Role

"HflC protein" in subsystem Hfl operon

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QI63 at UniProt or InterPro

Protein Sequence (292 amino acids)

>Dsui_3134 membrane protease subunit, stomatin/prohibitin (Dechlorosoma suillum PS)
MKQSFGLIGGLVAAIVVVLALSLFTVDQRQYAVVQQLGEVKSVITEPGLNFKWPLIQNVR
FFDRRILTMDSPEPERFITSEKKNVLVDSYVKWRIVDPKLYYISVGGDESRARTRLSQTV
NAGLREEFGKRTVHDVVSGERDKIMDDMREKADQDARKIGVQIVDVRLKRVELPQEVSES
VYRRMEAERKRVANELRSQGAAEAEKIRADADRQREVLVAEAYRDAQKIKGEGDAKAAAI
YGQAFGQNPEFFAFYRSMEAYRSTFKSKSDVMVLEPNSDFFKYMKNVGRSGK