Protein Info for Dsui_3122 in Dechlorosoma suillum PS

Annotation: PAS domain S-box

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 PF00989: PAS" amino acids 11 to 113 (103 residues), 25.5 bits, see alignment E=1.7e-09 PF13426: PAS_9" amino acids 19 to 112 (94 residues), 27.2 bits, see alignment E=5.8e-10 TIGR00229: PAS domain S-box protein" amino acids 24 to 113 (90 residues), 42.2 bits, see alignment E=4.2e-15 PF08447: PAS_3" amino acids 32 to 116 (85 residues), 49.4 bits, see alignment E=6.7e-17

Best Hits

KEGG orthology group: None (inferred from 66% identity to dar:Daro_4009)

Predicted SEED Role

"Signal transduction protein CetB, mediates an energy taxis response" in subsystem Flagellar motility

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QI53 at UniProt or InterPro

Protein Sequence (173 amino acids)

>Dsui_3122 PAS domain S-box (Dechlorosoma suillum PS)
MKDKSIVPTNRERVMRDNDFIVSKTDLSGRITYGNEIFIEFSGYSEAELLGTQHNIIRHP
DMPRAAFNLVWDTLKSGREIFAYVKNMSKDGSFYWVFAHITPDFGPRGDIVGYYSVRRCP
RRSAIDKIVPVYQQMLAAEKAAGSKDAIAAGTKVLTDLLQSSGMSYEQLVLSL