Protein Info for Dsui_3118 in Dechlorosoma suillum PS

Annotation: polyferredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 156 to 180 (25 residues), see Phobius details amino acids 200 to 221 (22 residues), see Phobius details PF12801: Fer4_5" amino acids 88 to 127 (40 residues), 36.8 bits, see alignment 1.6e-13 amino acids 202 to 236 (35 residues), 16.9 bits, see alignment 2.5e-07

Best Hits

KEGG orthology group: None (inferred from 72% identity to azo:azo3096)

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation" in subsystem Biogenesis of cbb3-type cytochrome c oxidases or Terminal cytochrome C oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QI49 at UniProt or InterPro

Protein Sequence (330 amino acids)

>Dsui_3118 polyferredoxin (Dechlorosoma suillum PS)
MNQRVIPIIPAAQAVAGNQRVQRQRLAAQMGFFVLFALAPVFDLFRYDLARGHALFLTFE
WRLGLDQFLAGRIGAGEAAFNVLTRLFLPILAGAAVFLWAAWKWGRLYCGWLCPHFSVVE
TINRVMIRASGKHSLWDKKPISPWRPDGTPAPRGPIWWLAVLPLAVAFAFVWAVVFLTYL
LPPMEVYTNLFNGALTRNQLIFIAAATTVISLEFLFARHLFCRYACAVGLFQSLAWMGNK
DALVVGFNRQRTAECADCLPDRQSACDAVCPMRLKPRTLKRMMFACTQCGQCLDACAQSQ
GRQDQPPLLQWVEAEAARQNEAGFSAVDRP