Protein Info for Dsui_3108 in Dechlorosoma suillum PS

Annotation: PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1104 PF00571: CBS" amino acids 7 to 60 (54 residues), 34.7 bits, see alignment 8.5e-12 amino acids 69 to 122 (54 residues), 40.2 bits, see alignment 1.6e-13 amino acids 135 to 187 (53 residues), 34 bits, see alignment 1.4e-11 amino acids 200 to 252 (53 residues), 39.6 bits, see alignment 2.5e-13 TIGR00229: PAS domain S-box protein" amino acids 272 to 400 (129 residues), 55.7 bits, see alignment E=5.4e-19 amino acids 406 to 523 (118 residues), 73.7 bits, see alignment E=1.5e-24 PF00989: PAS" amino acids 277 to 391 (115 residues), 32.8 bits, see alignment E=2.8e-11 amino acids 407 to 513 (107 residues), 67.1 bits, see alignment E=6e-22 PF08448: PAS_4" amino acids 282 to 396 (115 residues), 66.4 bits, see alignment E=1.1e-21 amino acids 408 to 517 (110 residues), 41 bits, see alignment E=8.8e-14 PF13426: PAS_9" amino acids 289 to 393 (105 residues), 41.6 bits, see alignment E=5.8e-14 amino acids 413 to 515 (103 residues), 67.8 bits, see alignment E=4e-22 PF13188: PAS_8" amino acids 406 to 453 (48 residues), 34.3 bits, see alignment (E = 7.1e-12) PF08447: PAS_3" amino acids 424 to 509 (86 residues), 33.7 bits, see alignment 1.7e-11 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 523 to 687 (165 residues), 145.3 bits, see alignment E=1.4e-46 PF00990: GGDEF" amino acids 527 to 684 (158 residues), 169.8 bits, see alignment E=1.9e-53 PF00563: EAL" amino acids 706 to 939 (234 residues), 221.5 bits, see alignment E=4.8e-69 PF13682: CZB" amino acids 980 to 1046 (67 residues), 48.5 bits, see alignment 4.2e-16

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QI39 at UniProt or InterPro

Protein Sequence (1104 amino acids)

>Dsui_3108 PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein (Dechlorosoma suillum PS)
MPERTLADLMTWNIVEVERRTTLLAAAEVMETARISSLLVREGALMVGIVTERDILRALS
ANVDGLLAVDQVMSSPVYTADSHMSVHHAYHLLAEKGIRHLLVTGEAGQPVGVVSESDFR
FHLGAAFFRRLRDVNAVMQSGVQLLQPGDTVRQALALMSASSLRCVVVAEAGRPLGILTE
RDALRFFRRGADSLEQPLAAVMSAPVASIPEGYPLSQAVDRMQAEHVRHLVVVGAAGEVV
GVVSEHDIVSQLESEYLDYVLQEGQSIRAQLRESRLRLSAVFNQTSEFIGILDLKGRLLE
ANQSALDLIGRQPAEVLGQLFWETPWWVHEPLVQQRLRQAVERVAAGGEAQRFEVTHMRR
DGRLRYVDFILKSVEDEPGQPLQLLAEGRDITDRKEGEEQHRLALSVFENSHDGILITNP
EGLIIEVNRAFCELTGYAREEAIGQPARMLNSGHHDRTYFRQLFQVVSERGFWKGEMWNR
TKSGAVTAVLMTVSAVHDDGGRISHFVGVFSDITQQKENQRRLERLAHYDALTGLPNRTL
MSDRLHLAMAQAQRRNKLLAVCYLDLDGFKAINDSHGHQAGDRLLMDVAERLRRSLRGGD
TAARLGGDEFVLLLNDLTALSELEQILERLLLSLAAPFALQGQTASVSGSIGVTIYPTDD
ADADTLVRHADQAMYAAKQSGRNRYQLFDTEQDSRARSLREAIVNARAALEQEQFRLYYQ
PKVNLCSGLIVGFEALIRWQHPEQGILAPAAFLVDLEETDLIVDIGDWVMETALAQLEAW
QALGWDYPVSINIAARHLQQPDFLPRLQRALERHPAVPPRLLELEILETAALEDVGQVSL
VIAACQRLGVGFALDDFGTGYSSLSYFKSLPARTLKIDQSFVRDMLHDPEALAIVEGVVG
LTSAFQRSVVAEGMETVEHGVMLLRLGCIHAQGYAIARPMPAAEVPAWAASFEPDPRWVE
VASQQWLREDFPLVAAQVEHRRWIDTVIQALEEGDAECLPADLADPTRCRFGIWYLGSGQ
QNYGDLAAYGALDGPHREVHALARAAAAQLQAGDARAAKAVIPQLRRHGRALLAALEQLQ
AAIIAQREPRCVAAPCADDLPVAP