Protein Info for Dsui_3105 in Dechlorosoma suillum PS

Annotation: CBS domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 56 to 78 (23 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details amino acids 141 to 165 (25 residues), see Phobius details PF01595: CNNM" amino acids 5 to 196 (192 residues), 176.5 bits, see alignment E=6.5e-56 PF00571: CBS" amino acids 281 to 330 (50 residues), 32.4 bits, see alignment 1.5e-11 PF03471: CorC_HlyC" amino acids 346 to 425 (80 residues), 74.3 bits, see alignment E=9.9e-25

Best Hits

Swiss-Prot: 45% identical to Y260_SYNY3: UPF0053 protein sll0260 (sll0260) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K03699, putative hemolysin (inferred from 61% identity to app:CAP2UW1_0012)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QI36 at UniProt or InterPro

Protein Sequence (438 amino acids)

>Dsui_3105 CBS domain-containing protein (Dechlorosoma suillum PS)
MDLGIILLLIVLNGIFAMSEIAVVSSRKARLQRMAEDGSQGAAAALKLHSEPSRFLSTIQ
VGITSIGILSGAVGEAALADPLTQWLSQFPLLGESARVIALSLTVVLLTYMSVVVGELVP
KQLALLGPEGIASLVARPMGWLSRLTAPLVWLFSASSGAILRLFGARRSDEPPVTDDEIK
VLMGQGAEAGVFHESEQEIVSNVLRLDEQRVAAIMTPRKDMYLVDLAESEAEVRRQVAEC
PYARVVVCQDGLDRVLGILQRGDLLKPVLENAPFNVRKALRPPVYVPESVTTTHLLESLR
RNRAQFALVIDEYGEVQGLVTLNDVLAAIVGDMPSQDDDGEQDVVEREDGSYLMDGGLSI
ERLKSVLEVKEELPGEEENAFHTLGGLVMHQLGRVPVEADHFHLAGWRFEVVDMDKNRVD
KVLLSLGDPETDDQADAA