Protein Info for Dsui_3078 in Dechlorosoma suillum PS

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 539 transmembrane" amino acids 9 to 31 (23 residues), see Phobius details amino acids 53 to 69 (17 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details PF00672: HAMP" amino acids 209 to 256 (48 residues), 35.5 bits, see alignment 1e-12 PF00015: MCPsignal" amino acids 366 to 504 (139 residues), 115.2 bits, see alignment E=3.1e-37

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 70% identity to dar:Daro_0926)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHL9 at UniProt or InterPro

Protein Sequence (539 amino acids)

>Dsui_3078 methyl-accepting chemotaxis protein (Dechlorosoma suillum PS)
MARIADLKIWVRLTAAIWFMLIAVWTGMIVWESEVNRETAIGQAKDFAGSIHEMTMAGLT
GMMITGTVGQREVFLDQIKQLSVIKDLHVVRGEAVSKIFGPDTKDKRPMDSIEQQAMQSG
KAYTAVHEENGATYLRVVTPTLASTNYLGKNCIMCHQVPEGSVLGLVSMKVSLDKVDAEV
NAFRLKIAAAAFGASLLLLAVIYLFIRHFVTIPIEHLTHGLQDIATGEGDLTRRLEVKGR
DEVGLAATVFNQVMENFSTLVRQVSQSATEVSAKAHALAQSASQVADGSHQQNEKSVTAA
SAVEQMVSSIAAISQSAEHVQQQSQESLKRSEEGNKSLGHLLEEMNNVEQTVKEMAESVN
EFVRNTDAINKMTQEVKDIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRKLAEKSSR
SASEIDAITETLSAQSVNVRRAIEEGLGHLSSSQASVTNVADILQAANGSVTEVGHGLDA
IAGATDEQRRVSGEVADSIEAIAAMARENNESVEQTAAAAQSLEALADSLQNTVGRFKV