Protein Info for Dsui_3062 in Dechlorosoma suillum PS

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 transmembrane" amino acids 17 to 38 (22 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details amino acids 84 to 108 (25 residues), see Phobius details amino acids 129 to 152 (24 residues), see Phobius details PF13664: DUF4149" amino acids 18 to 113 (96 residues), 67.9 bits, see alignment E=4.2e-23

Best Hits

KEGG orthology group: None (inferred from 38% identity to gca:Galf_1646)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHK3 at UniProt or InterPro

Protein Sequence (163 amino acids)

>Dsui_3062 hypothetical protein (Dechlorosoma suillum PS)
MTKPAVLSRLATALCRGLLVLWVGALWAVGYLAAPALFASLPRLVAGEVAGKLFFIVGWI
GMVAGILLLAYVRRTQVAGRERRLRLLLLSVLWLLAAAQLFWLQPVIAGIKAQLPPLPPD
VASLGPEFAFWHALSSALYLLQSLAGLILVMLGGVESRRPAVA