Protein Info for Dsui_3056 in Dechlorosoma suillum PS

Annotation: phosphate binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR02136: phosphate binding protein" amino acids 8 to 288 (281 residues), 330.2 bits, see alignment E=5.3e-103 PF12849: PBP_like_2" amino acids 23 to 275 (253 residues), 142.8 bits, see alignment E=1.8e-45 PF12727: PBP_like" amino acids 50 to 273 (224 residues), 44.2 bits, see alignment E=1.3e-15

Best Hits

Swiss-Prot: 58% identical to SPHX_SYNE7: Protein SphX (sphX) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K02040, phosphate transport system substrate-binding protein (inferred from 75% identity to app:CAP2UW1_2005)

Predicted SEED Role

"Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHJ7 at UniProt or InterPro

Protein Sequence (330 amino acids)

>Dsui_3056 phosphate binding protein (Dechlorosoma suillum PS)
MKFAKIAAALGLAGLAVSGIAHAQSALVKVDGSSTVYPITEAVAEDFQKEKKNAIKVTVG
ISGTGGGFKKFCRGETDVSNASRPILKKEMDACKELGIAYYELPIAYDALTVIVNPQNNF
IKNMTVAELKAIWEPAAQGKITNWNQVNPAYPDVPLKLYGPGADSGTFDYFTEAVVGKAK
SSRGDYTASEDDNVLVQGVSRDKGGLGYFGYAYYIENQKKLKAVSIDNGKGGVLPSPETV
ENGSYAPLSRPIFIYVNAKSLEKPEVKEFVEFYLKNAPKLVKEVKYVALPGKVYEANRER
LAKKKAGTVFGGTEAVGMKIEELIKREAQL