Protein Info for Dsui_3054 in Dechlorosoma suillum PS

Annotation: phosphate ABC transporter, permease protein PstA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 transmembrane" amino acids 26 to 50 (25 residues), see Phobius details amino acids 78 to 105 (28 residues), see Phobius details amino acids 125 to 145 (21 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details amino acids 200 to 220 (21 residues), see Phobius details amino acids 225 to 244 (20 residues), see Phobius details amino acids 252 to 269 (18 residues), see Phobius details amino acids 281 to 302 (22 residues), see Phobius details TIGR00974: phosphate ABC transporter, permease protein PstA" amino acids 28 to 307 (280 residues), 271.4 bits, see alignment E=3.6e-85 PF00528: BPD_transp_1" amino acids 96 to 310 (215 residues), 58.2 bits, see alignment E=4.6e-20

Best Hits

KEGG orthology group: K02038, phosphate transport system permease protein (inferred from 76% identity to nmu:Nmul_A1087)

Predicted SEED Role

"Phosphate transport system permease protein PstA (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHJ5 at UniProt or InterPro

Protein Sequence (312 amino acids)

>Dsui_3054 phosphate ABC transporter, permease protein PstA (Dechlorosoma suillum PS)
MSDTAVVAARLQEIRRIIARHKRWDLLFALLGLCALMLGVLTFVSLFAQMVVEGGPRLSM
DFFTNFPSRRPEQAGILSAWVGSTLVMIVTALAAVPLGVAAGVYLEEYAPKNLMTDIIEI
NVTNLAGVPSIVYGLLALGIFVYQFGFGQSILSAGLTLALLILPVVIVATREAIRAIPIY
VREGAYGCGATQWQVVRDHILPYSSAGILTGVIIGMARAIGETAPIITIGALTFIAFLPP
APFTGEPMAGPFDWVFAPFTVMPIQMFNWTSRPEEAFHQNAAAAGFVLVLMTLTMNALAI
WIRYRLRKNIKW