Protein Info for Dsui_3053 in Dechlorosoma suillum PS

Annotation: phosphate ABC transporter, ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 TIGR00972: phosphate ABC transporter, ATP-binding protein" amino acids 11 to 258 (248 residues), 379.8 bits, see alignment E=2.5e-118 PF00005: ABC_tran" amino acids 25 to 183 (159 residues), 103.4 bits, see alignment E=2.4e-33 PF13304: AAA_21" amino acids 116 to 213 (98 residues), 35.3 bits, see alignment E=2e-12

Best Hits

Swiss-Prot: 82% identical to PSTB_DECAR: Phosphate import ATP-binding protein PstB (pstB) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K02036, phosphate transport system ATP-binding protein [EC: 3.6.3.27] (inferred from 82% identity to dar:Daro_3565)

MetaCyc: 59% identical to phosphate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-27-RXN [EC: 7.3.2.1]; 7.3.2.1 [EC: 7.3.2.1]

Predicted SEED Role

"Phosphate transport ATP-binding protein PstB (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.27 or 7.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHJ4 at UniProt or InterPro

Protein Sequence (258 amino acids)

>Dsui_3053 phosphate ABC transporter, ATP-binding protein (Dechlorosoma suillum PS)
MTTATPIVKAEAKDLNFFYGGFHALKGLNMPVYEKKVTALIGPSGCGKSTFLRCFNRMHD
LYPGNRYQGAINFFPDQTNLLAEKVDPIEVRMRISMVFQKPNPFPKSIYENVAYGLRVRG
EKKRTVLDEKVEEALRGAALWDEVKDRLDDLAFNLSGGQQQRLCIARALATDPELLLFDE
PTSALDPIATASIEELVSELKEKVTILIVTHNMQQAARVSDFTAYMYLGELIEFGITDQI
FIKPQKKQTEDYITGRFG