Protein Info for Dsui_3040 in Dechlorosoma suillum PS

Annotation: NADH:ubiquinone oxidoreductase subunit 11 or 4L (chain K)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 101 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 30 to 51 (22 residues), see Phobius details amino acids 61 to 85 (25 residues), see Phobius details PF00420: Oxidored_q2" amino acids 6 to 101 (96 residues), 96.8 bits, see alignment E=2.5e-32

Best Hits

Swiss-Prot: 91% identical to NUOK_AROAE: NADH-quinone oxidoreductase subunit K (nuoK) from Aromatoleum aromaticum (strain EbN1)

KEGG orthology group: K00340, NADH dehydrogenase I subunit K [EC: 1.6.5.3] (inferred from 91% identity to eba:ebB168)

MetaCyc: 48% identical to ferredoxin-plastoquinone oxidoreductase subunit E (Synechococcus elongatus PCC 7942 = FACHB-805)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain K (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHI2 at UniProt or InterPro

Protein Sequence (101 amino acids)

>Dsui_3040 NADH:ubiquinone oxidoreductase subunit 11 or 4L (chain K) (Dechlorosoma suillum PS)
MLTLSHFLVLGAILFAISVLGIFLNRKNLIVLLMAIELMLLAVNMNFIAFSHYMQDLAGQ
LAVFFILVVAAAESAIGLAILVVLFRNLRTIHVDDLDSLKG