Protein Info for Dsui_3038 in Dechlorosoma suillum PS

Annotation: proton-translocating NADH-quinone oxidoreductase, chain M

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 34 to 53 (20 residues), see Phobius details amino acids 84 to 104 (21 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 207 to 227 (21 residues), see Phobius details amino acids 241 to 262 (22 residues), see Phobius details amino acids 275 to 295 (21 residues), see Phobius details amino acids 302 to 321 (20 residues), see Phobius details amino acids 333 to 351 (19 residues), see Phobius details amino acids 372 to 393 (22 residues), see Phobius details amino acids 405 to 426 (22 residues), see Phobius details amino acids 452 to 470 (19 residues), see Phobius details TIGR01972: proton-translocating NADH-quinone oxidoreductase, chain M" amino acids 6 to 487 (482 residues), 627.4 bits, see alignment E=7.9e-193 PF01059: Oxidored_q5_N" amino acids 59 to 126 (68 residues), 30.3 bits, see alignment E=3.9e-11 PF00361: Proton_antipo_M" amino acids 133 to 415 (283 residues), 267.2 bits, see alignment E=1.8e-83

Best Hits

Swiss-Prot: 44% identical to NU4M_BRACM: NADH-ubiquinone oxidoreductase chain 4 (ND4) from Brassica campestris

KEGG orthology group: K00342, NADH dehydrogenase I subunit M [EC: 1.6.5.3] (inferred from 85% identity to app:CAP2UW1_3769)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain M (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHI0 at UniProt or InterPro

Protein Sequence (493 amino acids)

>Dsui_3038 proton-translocating NADH-quinone oxidoreductase, chain M (Dechlorosoma suillum PS)
MSGYLLSLAIWTPIVAGLVVLFTGSDRNAPLARGLALLGAVLGLLVTLPLYTGFDKATSA
MQFVEQASWIAPFNINYHLGVDGISMPFVILNAFITILVVLAGWKVIEQRVAQYNAAFLI
MSGLLNGIFCALDGVLFYVFFEASLIPLYLIIGMWGGPNRVYAAIKFFLYTLMGSLLFLI
ALIYLFFQSGGSFSIQDWHQLPLDLTTQIWLFLAFLVAFAVKVPMWPVHTWLPDAHVEAP
TGGSVVLAAIALKLGAYGFLRFSLPIAPDASHELSGLMIGLSLIAVIYIGFVALVQADMK
KLVAYSSIAHMGFVTLGFFMLNPLGVEGALVQMISHGFVSGAMFLCIGVLYDRMHSRQIA
DYGGVVNTMPKFAAFFMLFSMANAGLPATSGFVGEFMVILGAVEYNFWVAFAAATTMIVG
AAYTLWMYKRVVFGAVANSHVAELEDINAREFFFLAILALCVLGMGLYPLPFTEVMHASV
NDLLQHVAQSKLQ