Protein Info for Dsui_3032 in Dechlorosoma suillum PS

Annotation: phosphotransacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01575: MaoC_dehydratas
  • amino acids 28 to 121 (94 residues), 62.6 bits, E=2.8e-21
• PF01515: PTA_PTB
  • amino acids 244 to 459 (216 residues), 145.7 bits, E=2.3e-46

Best Hits

KEGG orthology group: K00625, phosphate acetyltransferase [EC: 2.3.1.8] (inferred from 79% identity to dar:Daro_0975)

Predicted SEED Role

"Phosphate acetyltransferase (EC 2.3.1.8)" in subsystem Ethanolamine utilization or Fermentations: Lactate or Fermentations: Mixed acid or MLST or Propanediol utilization or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or Threonine anaerobic catabolism gene cluster (EC 2.3.1.8)

MetaCyc Pathways

• pyruvate fermentation to acetate and (S)-lactate I (4/4 steps found)
• pyruvate fermentation to acetate II (3/3 steps found)
• superpathway of acetate utilization and formation (3/3 steps found)
• L-threonine degradation I (5/6 steps found)
• acetate and ATP formation from acetyl-CoA I (2/2 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
• pyruvate fermentation to acetate and lactate II (3/4 steps found)
• pyruvate fermentation to acetate I (2/3 steps found)
• pyruvate fermentation to acetate IV (2/3 steps found)
• pyruvate fermentation to acetate VII (2/3 steps found)
• sulfoacetaldehyde degradation I (1/2 steps found)
• mixed acid fermentation (11/16 steps found)
• (S)-propane-1,2-diol degradation (3/5 steps found)
• acetylene degradation (anaerobic) (3/5 steps found)
• ethanolamine utilization (3/5 steps found)
• acetyl-CoA fermentation to butanoate (4/7 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (5/9 steps found)
• sulfolactate degradation II (1/4 steps found)
• heterolactic fermentation (11/18 steps found)
• superpathway of L-threonine metabolism (11/18 steps found)
• methanogenesis from acetate (2/6 steps found)
• superpathway of sulfolactate degradation (2/6 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)
• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (3/8 steps found)
• superpathway of N-acetylneuraminate degradation (13/22 steps found)
• superpathway of taurine degradation (1/6 steps found)
• superpathway of L-alanine fermentation (Stickland reaction) (3/9 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (3/9 steps found)
• L-lysine fermentation to acetate and butanoate (3/10 steps found)
• gallate degradation III (anaerobic) (3/11 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (7/17 steps found)
• purine nucleobases degradation II (anaerobic) (10/24 steps found)
• superpathway of methanogenesis (2/21 steps found)
• superpathway of L-lysine degradation (9/43 steps found)

KEGG Metabolic Maps

• Propanoate metabolism
• Pyruvate metabolism
• Taurine and hypotaurine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.8

Sequence Analysis Tools

See G8QHH4 at UniProt or InterPro

Protein Sequence (470 amino acids)

>Dsui_3032 phosphotransacetylase (Dechlorosoma suillum PS)
MHAEHTEQYIENKTFDEIQVGDSSTLIRTLRPEDIKLFAIMSGDVNPSVVDPEFAQSGIF
REVVAHGMWSGALISTVLGTQFPGPGTIYIDQSLHFSRPVTIGDTVTITITAKQKFDHNK
HILFDCQCTNQEGLQVVSGTAEVLAPTEKIRRERVHLPEFTISDKEARYQALLATAAGLE
PIPVAVAHPCDAESLKGPIFAARAGLIEPFLVGPEAKIRSVAEENGLDLTGIRIVNTRHS
HESAAMAVTLVRNGDCEALMKGSLHTDELMGEVVSRANGLRTSRRISHVFYMDVPTYPKP
IMITDAAINIAPTLEDKVDIIQNAIDLFHILGNPEPKVAILSAVETVNPKIQSTLDAAAL
CKMADRGQIKGGLLDGPLAFDNAVSLVAAKTKGIKSAVAGQADILVVPDLESGNMVAKQL
EYLANALSAGVVLGAKCPIVLTSRADTAETRTASCAIAALMAHAYRKQNQ