Protein Info for Dsui_3024 in Dechlorosoma suillum PS

Annotation: phosphate transport regulator related to PhoU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 PF01865: PhoU_div" amino acids 7 to 205 (199 residues), 89.7 bits, see alignment E=9.1e-30

Best Hits

KEGG orthology group: K07220, hypothetical protein (inferred from 61% identity to mpt:Mpe_A3016)

Predicted SEED Role

"Phosphate transport regulator (distant homolog of PhoU)" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHG6 at UniProt or InterPro

Protein Sequence (207 amino acids)

>Dsui_3024 phosphate transport regulator related to PhoU (Dechlorosoma suillum PS)
MPQEGKFFDLFNAHAEQIVQGGQALATFINHLGRNPEEATQAADAVDTAESRADKITHET
VALLHKTFITPLDRDEIHSLITGMDDILDLIQDVTQTVSLYDIRKGTPEAIQLAEICVSC
CDRVRWAVSLLPNADQGPAILKTCEEIDRLESDADRVMRSAMSRLFRDEPDVRQLIKLKA
IYELLETVTDRCEDVANILEGIVLENS