Protein Info for Dsui_3021 in Dechlorosoma suillum PS

Annotation: putative permease, DMT superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 57 (20 residues), see Phobius details amino acids 69 to 91 (23 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 128 to 146 (19 residues), see Phobius details amino acids 152 to 169 (18 residues), see Phobius details amino acids 179 to 202 (24 residues), see Phobius details amino acids 209 to 232 (24 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details amino acids 267 to 285 (19 residues), see Phobius details PF00892: EamA" amino acids 9 to 142 (134 residues), 60.7 bits, see alignment E=9.8e-21 amino acids 151 to 284 (134 residues), 69.4 bits, see alignment E=2e-23

Best Hits

KEGG orthology group: None (inferred from 65% identity to app:CAP2UW1_2400)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHG3 at UniProt or InterPro

Protein Sequence (295 amino acids)

>Dsui_3021 putative permease, DMT superfamily (Dechlorosoma suillum PS)
MRALPQRLRGGLWIAASAAGFGAMAIFAKLAYAEGVGLETLLFLRFALGGACLALILRWR
RQAWPAPALWPGLAAMGGIGYVGQSYCYFAALRHASAGLTAVLLYLYPVLVTLLAALLGR
QRLSGRKLLAVGAAFVGTLLTIGGSLAGTPLGIGLGLAAALIYSVYILAGERLTARAGAL
ASAAVIMLAAAVVFGVLAFHAASPWPASLAGWAAVLGIVVFSTIVGMVGFFAGMAKLGAA
DAATLSTLEPVVTLVLAALFLGEVVGGWQLAGGALILGAVVVLVRSPVMPERRAG