Protein Info for Dsui_3011 in Dechlorosoma suillum PS

Annotation: Fe-S-cluster-containing hydrogenase subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 294 to 313 (20 residues), see Phobius details PF10518: TAT_signal" amino acids 2 to 20 (19 residues), 25.8 bits, see alignment (E = 3.3e-09) TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 2 to 29 (28 residues), 21.9 bits, see alignment (E = 8.4e-09) PF12838: Fer4_7" amino acids 51 to 133 (83 residues), 27 bits, see alignment E=2.2e-09 amino acids 117 to 164 (48 residues), 36.6 bits, see alignment 2.3e-12 PF13247: Fer4_11" amino acids 111 to 206 (96 residues), 78.1 bits, see alignment E=2.2e-25 PF13237: Fer4_10" amino acids 114 to 161 (48 residues), 28.7 bits, see alignment 4.6e-10 amino acids 144 to 199 (56 residues), 25.5 bits, see alignment E=4.6e-09 PF12837: Fer4_6" amino acids 142 to 164 (23 residues), 29.2 bits, see alignment (E = 2.9e-10) PF12797: Fer4_2" amino acids 143 to 162 (20 residues), 26.5 bits, see alignment (E = 1.9e-09) PF00037: Fer4" amino acids 145 to 164 (20 residues), 26.2 bits, see alignment (E = 2.3e-09)

Best Hits

Swiss-Prot: 47% identical to HYBA_ECO57: Hydrogenase-2 operon protein HybA (hybA) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 70% identity to rfr:Rfer_4089)

MetaCyc: 47% identical to hydrogenase 2 iron-sulfur protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Respiratory nitrate reductase beta chain (EC 1.7.99.4)" in subsystem Nitrate and nitrite ammonification (EC 1.7.99.4)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.7.99.4

Use Curated BLAST to search for 1.7.99.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QH13 at UniProt or InterPro

Protein Sequence (324 amino acids)

>Dsui_3011 Fe-S-cluster-containing hydrogenase subunit (Dechlorosoma suillum PS)
MTSRRNFLKGTLAGGAAAAAVSVSVSGPACARDNNPQPEGALGLLYDATLCVGCKACVAA
CKEVNGNPAEFSTPEQLWDTPLDTTAKTFNVIKMFRSGTMETKDDPDNGYAFMKTSCLHC
NDPSCVSACPVSAMTKDPVTGIVGYDADACIGCRYCVAACPFGIPKYDYSSATGKIGKCE
LCRHRLPEGKYAACAEVCPTGATLYGKVSDLKAEAERRLSLKPGTKTVFQRGQLGGKDQS
YENVVGHYVQHVYGEKEVGGTQVIKLSAVPFEKVGHKPLPERSASSKSETLQHTLYGGLV
MPLAVLGVMTYFAKRNVKPDDDEL