Protein Info for Dsui_3010 in Dechlorosoma suillum PS

Annotation: polysulfide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 57 to 83 (27 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 134 to 153 (20 residues), see Phobius details amino acids 173 to 198 (26 residues), see Phobius details amino acids 211 to 235 (25 residues), see Phobius details amino acids 251 to 269 (19 residues), see Phobius details amino acids 284 to 303 (20 residues), see Phobius details amino acids 315 to 334 (20 residues), see Phobius details amino acids 351 to 370 (20 residues), see Phobius details PF03916: NrfD" amino acids 46 to 331 (286 residues), 62.5 bits, see alignment E=2.8e-21

Best Hits

KEGG orthology group: None (inferred from 71% identity to dar:Daro_3972)

Predicted SEED Role

"Ni/Fe-hydrogenase 2 B-type cytochrome subunit" in subsystem Hydrogenases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QH12 at UniProt or InterPro

Protein Sequence (385 amino acids)

>Dsui_3010 polysulfide reductase (Dechlorosoma suillum PS)
MSAQQHAAPTPVGGKLLTPVTLTAATLIVVALAIILVRFVFGLGAVTNLNDGYPWGLWVV
GDVVIGSAFACGGFSVAMLVYIFNRGEYHPLVRPALLASLFGYTLAGVGVIFDLGRWWNF
WHILTPGYASANSVMFEVALCISLYIVVMWIEFSPTFMEKWGMHEKRKKLNKVMFFFIAL
GTVLPMMHQSSLGSLLVVMGTQVHPLWQSMALPLIYLLSAITIGYAVILFESCMAAAGFR
RQMETHILTPLSKVMLGMLAVFLVVRMGDLLVRGALPRAFEGSLQALMFWLEMACFIAPL
ALLGKEASRRNPARLFVGAVLLMLGGVLLRINSYLVGYETGDGWHYFPSVPEMLVTFGMF
AIEVFGYIVITRRFPVLAAEDAAAH