Protein Info for Dsui_3008 in Dechlorosoma suillum PS

Annotation: hydrogenase expression/formation protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00140: hydrogenase expression/formation protein
  • amino acids 7 to 156 (150 residues), 172.8 bits, E=4.7e-55
• TIGR00072: hydrogenase maturation protease
  • amino acids 9 to 152 (144 residues), 159.8 bits, E=4.5e-51
• PF01750: HycI
  • amino acids 24 to 150 (127 residues), 127.8 bits, E=1.2e-41

Best Hits

Swiss-Prot: 55% identical to HYBD_ECOLI: Hydrogenase 2 maturation protease (hybD) from Escherichia coli (strain K12)

KEGG orthology group: K08567, hydrogenase 2 maturation protease [EC: 3.4.24.-] (inferred from 59% identity to dar:Daro_3970)

MetaCyc: 55% identical to hydrogenase 2 maturation protease (Escherichia coli K-12 substr. MG1655)
RXN-22655 [EC: 3.4.23.51]

Predicted SEED Role

"Hydrogenase maturation protease (EC 3.4.24.-)" in subsystem Membrane-bound Ni, Fe-hydrogenase (EC 3.4.24.-)

MetaCyc Pathways

• NiFe(CO)(CN)₂ cofactor biosynthesis (3/10 steps found)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.23.51 or 3.4.24.-

Sequence Analysis Tools

See G8QH10 at UniProt or InterPro

Protein Sequence (166 amino acids)

>Dsui_3008 hydrogenase expression/formation protein (Dechlorosoma suillum PS)
MTTTPTIAVLGVGNILLTDEGIGVRIVDELQRRYSLPEHVLVLDGGTAGMELLEPLEGLD
KLIIADAVRVGQPPGSVVLLQGDEVPKFFRTKISPHQIGLSDLLAALELTEKAPKAVALI
GLQPVSLDTGMALTPEAEAKVPEMLELVLAELAKAGVVPQAIEGAA