Protein Info for Dsui_3004 in Dechlorosoma suillum PS

Annotation: PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 868 PF00571: CBS" amino acids 7 to 57 (51 residues), 25.7 bits, see alignment 4.8e-09 amino acids 71 to 123 (53 residues), 49.3 bits, see alignment 2e-16 amino acids 136 to 188 (53 residues), 24.7 bits, see alignment 9.6e-09 amino acids 198 to 251 (54 residues), 32.3 bits, see alignment 4.1e-11 PF13188: PAS_8" amino acids 282 to 323 (42 residues), 21.3 bits, see alignment 8e-08 amino acids 414 to 457 (44 residues), 19.3 bits, see alignment 3.4e-07 TIGR00229: PAS domain S-box protein" amino acids 283 to 398 (116 residues), 55.8 bits, see alignment E=5.2e-19 amino acids 415 to 528 (114 residues), 48.5 bits, see alignment E=9e-17 PF00989: PAS" amino acids 283 to 389 (107 residues), 35.5 bits, see alignment E=3.5e-12 amino acids 416 to 470 (55 residues), 34.6 bits, see alignment 7e-12 PF08448: PAS_4" amino acids 285 to 394 (110 residues), 31.2 bits, see alignment E=9.1e-11 amino acids 417 to 524 (108 residues), 63.1 bits, see alignment E=1.1e-20 PF13426: PAS_9" amino acids 290 to 391 (102 residues), 60.6 bits, see alignment E=6.3e-20 amino acids 421 to 521 (101 residues), 25.3 bits, see alignment E=6.4e-09 PF08447: PAS_3" amino acids 302 to 385 (84 residues), 26.2 bits, see alignment E=3.2e-09 PF13185: GAF_2" amino acids 543 to 687 (145 residues), 55.9 bits, see alignment E=2.2e-18 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 695 to 859 (165 residues), 173.1 bits, see alignment E=4e-55 PF00990: GGDEF" amino acids 699 to 856 (158 residues), 150.8 bits, see alignment E=1.2e-47

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QH06 at UniProt or InterPro

Protein Sequence (868 amino acids)

>Dsui_3004 PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein (Dechlorosoma suillum PS)
MHYDLPISQILRHELLECAPQTTVAEAAGRMHQARCGSILVVELGEVRGIWTERDALALN
FSDPESIHLPVSRVMSTPVKTVRETDTVAEAAIRFKQERLRHLLVVDRDGRRLGIVSQTD
IVNHQGVEFYVHMRDVGSVLKSAPLQVPGSMPVAEAVQRLREARSDAAIVEHNGHLGILT
GRDVLRLIGQESLNCSAGEVATFPLITVPRSSTLYHTRKIFNDRRIRHLGVMDEHGRITG
LLSYADILDSVEQEYVAELRAALQEQSQRLQQSRHALLLASKVAESSQQAIMIVNAERII
QSINPAFSAITGYSAEEAVGHDTRLLKSGLHDADFYRQLYADLAAFGVWSGEIWNRRKNG
ELYPENLTITSVKGEGGQVINYVCVFTDMTEQKRARDDLKESHQRLEQQSSLTEMILDTL
PVMVFVKDEDGRYLVMNEAAAAFVGHDKHEVVGRSDFELYPADVASRLRQDDIKALAAKK
VTGREEKHLTPKGERYLLSYKRGVDLGGRRLLIGSSTDISERKQAEQLLAAERQVLELIA
SDASLQVVLDALCNRVESLISDCFAAVLLLQPDNGHLVLGSAPSLRRTCRDVGQNCPENP
AVCACAAAIRTGKQIIAEHIDDSEQWQDCRDFASALGLKTAWSTPIVSPGKEVLGTLSLY
FRQGRRPNRFDKDVIEHACRQAAIAIDRNRAMDSLHRLATVDTLTGLNNRSRFLDQGEAE
ITRARRLGRSVAVLMLDVDHFKRINDTHGHGAGDVALKIVAAIIARELRAIDICGRLGGE
EFAVMLPETDGQGAMQAAERLRQAVAQEKVRVAEGVELGITVSIGATILAPQDANIDHLL
ARADGALYEAKRSGRNLALYAAPGNIPS