Protein Info for Dsui_2998 in Dechlorosoma suillum PS

Annotation: ABC-type phosphate/phosphonate transport system, periplasmic component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF12974: Phosphonate-bd" amino acids 44 to 272 (229 residues), 158.9 bits, see alignment E=7.7e-51

Best Hits

KEGG orthology group: K02044, phosphonate transport system substrate-binding protein (inferred from 48% identity to geb:GM18_0069)

Predicted SEED Role

"Phosphonate ABC transporter phosphate-binding periplasmic component (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QH00 at UniProt or InterPro

Protein Sequence (288 amino acids)

>Dsui_2998 ABC-type phosphate/phosphonate transport system, periplasmic component (Dechlorosoma suillum PS)
MGPLLRRLSGLLWAGLLMLPLAAPAAPATAKTTAGKPAERVYTLGVTPQFERRQLFAIWK
PILIELEKRTGLRFDLAIMPDIPSFERQYNAGAFDFAYMNPYLMVANPAGYIPLVRDETP
VTGILVVARDSPFRTPADLEGKEIAFPAPNAIGASLLIRAELVRKYKVNFTPRYVNSHTA
VYLSVTQSLASAGGGVQKTLNEQKPEVQERLRVLYRTAAFAAHPIAAHPRVDAAVREQVR
SALLDFAATPAGKALLQEIPLARMVPTAMKDYQPLKDLGLEDFFVPER