Protein Info for Dsui_2981 in Dechlorosoma suillum PS

Annotation: electron transport complex, RnfABCDGE type, C subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 593 TIGR01945: electron transport complex, RnfABCDGE type, C subunit" amino acids 6 to 439 (434 residues), 543.9 bits, see alignment E=1.1e-167 PF13375: RnfC_N" amino acids 8 to 109 (102 residues), 113 bits, see alignment E=2.3e-36 PF05896: NQRA" amino acids 27 to 244 (218 residues), 29.5 bits, see alignment E=2.2e-10 PF01512: Complex1_51K" amino acids 133 to 276 (144 residues), 150.1 bits, see alignment E=1.9e-47 PF10531: SLBB" amino acids 292 to 337 (46 residues), 37.1 bits, see alignment 9.1e-13 PF13237: Fer4_10" amino acids 369 to 420 (52 residues), 26.6 bits, see alignment 1.9e-09 PF12838: Fer4_7" amino acids 370 to 422 (53 residues), 29.7 bits, see alignment 2.9e-10

Best Hits

KEGG orthology group: K03615, electron transport complex protein RnfC (inferred from 80% identity to dar:Daro_1161)

Predicted SEED Role

"Electron transport complex protein RnfC" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGY4 at UniProt or InterPro

Protein Sequence (593 amino acids)

>Dsui_2981 electron transport complex, RnfABCDGE type, C subunit (Dechlorosoma suillum PS)
MGLMQLFKFKGGVKPATNKAQSVTLPIAKAPVPSVVAVPLHQSIGGTPRPLVQVGDKVLK
GQMIGEADGWISAAVHAPTSGTVREVGMYAAAHPSGLLTDCVVIEPDGEDRWIERQSVDY
KTLTPEQVRELLRDMGVVGLGGAVFPSHAKTQASRSVPMEELVINGAECEPYITCDDLLM
RDRAAEVVKGIAIFRDLLQPKKVLIGIEDNKPEAAAAMALAVQAAGEDFQVVSVPTLYPA
GGAKQLIRVLTGKEVPANKRSTDMGVQCFNVATAYTAWRALGHGEPVISRLVTLTGNVAE
PRNYEVLIGTPMDELLAIAGPKADTDGIIMGGPMMGFLVPEAKAPVVKATNCLIAHSPAL
FPPKAPEMPCIRCGSCAQVCPHELQPFEMYWFARAKNFGKTQEYNIFDCIECGCCSFVCP
SRIPLVQYFRFAKSEIWARERDKKAADGAKTRFEFKQLRDEREKQEKAEKLAKAAAAQAA
KKAAEAAAAAAAEGGAPAEAAAAPAAQSPEEAAAAAKKAAIAAAMERAKAQRAQAQPQNT
DDLAPAQQQEVADIEARRARLRDIAKTELAHPEAHPAEAAPAAPADDGQTPKN