Protein Info for Dsui_2976 in Dechlorosoma suillum PS

Annotation: Fe2+-dicitrate sensor, membrane component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 transmembrane" amino acids 93 to 110 (18 residues), see Phobius details PF16220: DUF4880" amino acids 16 to 58 (43 residues), 50.3 bits, see alignment 1.7e-17 PF04773: FecR" amino acids 122 to 225 (104 residues), 61.5 bits, see alignment E=8.6e-21

Best Hits

KEGG orthology group: None (inferred from 43% identity to avn:Avin_01110)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGX9 at UniProt or InterPro

Protein Sequence (339 amino acids)

>Dsui_2976 Fe2+-dicitrate sensor, membrane component (Dechlorosoma suillum PS)
MSARAGIQATDYQVLQAAAEWFAVLHDPGVSAAERQRWQAWLEAREEHRRAWQQVEAVSR
SFASLPRAGQSGEAARLAVEAGSRQRRMQRRQAMKALVLFAAVGGMAWGGQRLGLWPGEA
ADFETARGETREVQLADGTRVWLNTDSAISVRFQTGERRLGLLRGEVLVETGKGEPGVDD
EAALRPLRLATPEGLLRPLGTRFLVRRDEDAGAGESLAVFAGAVEITPHDQPGTRQVIAA
GQEVRYDRNGVATPVPAQAARQAWSRGMLVADDMRLGDFLAELSRYRSGHLGWDPAVAEL
RLVGAFPLGDTDRILASLEESLPLRVRRTLPWWVSVEPR