Protein Info for Dsui_2973 in Dechlorosoma suillum PS

Annotation: putative arginyl-tRNA:protein arginylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF04376: ATE_N" amino acids 23 to 92 (70 residues), 87.8 bits, see alignment E=4.5e-29 PF04377: ATE_C" amino acids 113 to 235 (123 residues), 144 bits, see alignment E=3.5e-46

Best Hits

Swiss-Prot: 68% identical to BPT_DECAR: Aspartate/glutamate leucyltransferase (bpt) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K00685, arginine-tRNA-protein transferase [EC: 2.3.2.8] (inferred from 71% identity to app:CAP2UW1_1929)

Predicted SEED Role

"Arginine-tRNA-protein transferase (EC 2.3.2.8)" in subsystem Protein degradation (EC 2.3.2.8)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGX6 at UniProt or InterPro

Protein Sequence (257 amino acids)

>Dsui_2973 putative arginyl-tRNA:protein arginylyltransferase (Dechlorosoma suillum PS)
MSQLNDSSLPFSLLQFYATSPYGCSYLPEQQARSQVATPTHLINTEIYSELVRAGFRRSG
VFTYRPWCDACRACVPARIPVQRFAPDRTQRRVARQHENLVAREVPLEFAASHYELYQRY
QANRHAGGGMDQDSHEQYAHFLLQSRVDTRLVEFLEPGSGAVRMVSVIDVLTDGLSSVYT
FYDPDVPGASYGTYNILWQIQQCRELDLPHLYLGYWIGASRKMAYKIRFKPLEGLVDGEW
QELEALAAAQTEPAPQP