Protein Info for Dsui_2967 in Dechlorosoma suillum PS

Annotation: precorrin-3B C17-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K05934, precorrin-3B C17-methyltransferase [EC: 2.1.1.131] (inferred from 85% identity to dar:Daro_1685)

Predicted SEED Role

"Cobalt-precorrin-3b C17-methyltransferase" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

adenosylcobalamin biosynthesis II (aerobic) (27/33 steps found)
adenosylcobalamin biosynthesis I (anaerobic) (29/36 steps found)
cob(II)yrinate a,c-diamide biosynthesis I (early cobalt insertion) (13/15 steps found)
cob(II)yrinate a,c-diamide biosynthesis II (late cobalt incorporation) (9/13 steps found)

KEGG Metabolic Maps

Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.131

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGX0 at UniProt or InterPro

Protein Sequence (331 amino acids)

>Dsui_2967 precorrin-3B C17-methyltransferase (Dechlorosoma suillum PS)
MTDIQTNAPAKTGKIMLVGLGPGAVEHMTGRARAAIAEADTIIGYVTYVRLVADLIDGKE
VIKKSMTEELDRAIEALDRAKQGKKVALISSGDAGVYGMAGPTFEVLFQAGWTPESDIEV
EIVPGASALNTCAALVGAPLTHDFCAISLSDLLTPWPTIARRLDAVAYADFVVALYNPKS
GRRTRQIQEAQRIFLRHRDPKTPVAIVKSAFRPKQRLEFTTLEKMAEADIGMLSTVLIGN
SNTFIRDGLMVTPRGYANKYDVAEGERSTKGGEQAGRSLSTGLNGWLEAIRDSGKSAAEL
AVEYRLPEDYIAAALAAGPEAADETEAEAEA