Protein Info for Dsui_2965 in Dechlorosoma suillum PS

Annotation: cobalamin biosynthesis protein CbiG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 transmembrane" amino acids 71 to 93 (23 residues), see Phobius details amino acids 126 to 139 (14 residues), see Phobius details PF11760: CbiG_N" amino acids 70 to 148 (79 residues), 111.6 bits, see alignment E=1.5e-36 PF11761: CbiG_mid" amino acids 154 to 255 (102 residues), 46.3 bits, see alignment E=3.9e-16

Best Hits

KEGG orthology group: K02189, cobalamin biosynthesis protein CbiG (inferred from 79% identity to azo:azo3535)

Predicted SEED Role

"Cobalamin biosynthesis protein CbiG" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGW8 at UniProt or InterPro

Protein Sequence (261 amino acids)

>Dsui_2965 cobalamin biosynthesis protein CbiG (Dechlorosoma suillum PS)
MTIPLPFPNERIAVVSITRHGIALAGKVVAALPGARLFAPEKFRAEAEAAVASTPGAAAT
YSGKTGDQIPALFANFDGIVAIVSLGALVRLIAPHLKDKEQDPGVVVVDEAGRFAIPMLS
GHLGGANALAGILAASLGATPVLTTASDSRQTLGVDLLGRELGWTFEATHDEVVKASAAV
VNDEPVALVQEAGSPDWWPRHANGRSGPVPANIKQFSRLEEVDLDSVAAVLWISHRPLPP
ELAPRLAGRLVTYRPPVEQGA