Protein Info for Dsui_2956 in Dechlorosoma suillum PS

Annotation: ABC-type cobalt transport system, periplasmic component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 123 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 71 to 92 (22 residues), see Phobius details PF02553: CbiN" amino acids 6 to 81 (76 residues), 93.4 bits, see alignment E=3.4e-31

Best Hits

Swiss-Prot: 46% identical to CBIN_STRCO: Cobalt transport protein CbiN (cbiN) from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)

KEGG orthology group: K02009, cobalt transport protein (inferred from 68% identity to app:CAP2UW1_2052)

Predicted SEED Role

"Additional substrate-specific component CbiN of cobalt ECF transporter" in subsystem Coenzyme B12 biosynthesis or ECF class transporters or Transport of Nickel and Cobalt

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGV9 at UniProt or InterPro

Protein Sequence (123 amino acids)

>Dsui_2956 ABC-type cobalt transport system, periplasmic component (Dechlorosoma suillum PS)
MKRHQNLLLLIAVVLLAALPLWLVERPLGPDGQPAEIFGGADSQAQALITRIAPDYQPWF
QPLLEPASGEIASLLFALQAALGAGFIGYYLGCARTREKLRREQRRGEAAARREDEDQEG
PAC