Protein Info for Dsui_2948 in Dechlorosoma suillum PS

Annotation: RNA polymerase sigma factor, sigma-70 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 9 to 153 (145 residues), 68.8 bits, see alignment E=2.1e-23 PF04542: Sigma70_r2" amino acids 12 to 76 (65 residues), 52.7 bits, see alignment E=6e-18 PF07638: Sigma70_ECF" amino acids 33 to 152 (120 residues), 23.4 bits, see alignment E=1e-08 PF08281: Sigma70_r4_2" amino acids 109 to 155 (47 residues), 55.7 bits, see alignment E=6.1e-19 PF04545: Sigma70_r4" amino acids 113 to 156 (44 residues), 38.7 bits, see alignment E=1.1e-13

Best Hits

Swiss-Prot: 51% identical to FECI_ECOLI: Probable RNA polymerase sigma factor FecI (fecI) from Escherichia coli (strain K12)

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 65% identity to neu:NE1071)

MetaCyc: 51% identical to RNA polymerase sigma factor FecI (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGV1 at UniProt or InterPro

Protein Sequence (165 amino acids)

>Dsui_2948 RNA polymerase sigma factor, sigma-70 family (Dechlorosoma suillum PS)
MAIVSSDPLAHLYRAHHGWLHGWLRRQLGCSHQAADLAQDTFLRLLGRRSADLGEPRALL
THIAKGLVVDHWRRRAVEQAYLEVLARLPEAQAPSPETRLLVLEALCRVDAMLAGLPPRT
REIFLLSQLDGLTYGAIAERLGTSLITVKRHMRNGFIACMAALED