Protein Info for Dsui_2946 in Dechlorosoma suillum PS

Annotation: DNA/RNA helicase, superfamily II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 PF00270: DEAD" amino acids 45 to 210 (166 residues), 157.3 bits, see alignment E=6.2e-50 PF04851: ResIII" amino acids 59 to 204 (146 residues), 29.8 bits, see alignment E=1.1e-10 PF00271: Helicase_C" amino acids 246 to 352 (107 residues), 95.6 bits, see alignment E=4.6e-31 PF03880: DbpA" amino acids 406 to 471 (66 residues), 66.2 bits, see alignment E=4.5e-22

Best Hits

KEGG orthology group: K05591, ATP-independent RNA helicase DbpA [EC: 3.6.4.13] (inferred from 77% identity to slt:Slit_0667)

Predicted SEED Role

"ATP-dependent 23S rRNA helicase DbpA"

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.13

Use Curated BLAST to search for 3.6.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGU9 at UniProt or InterPro

Protein Sequence (476 amino acids)

>Dsui_2946 DNA/RNA helicase, superfamily II (Dechlorosoma suillum PS)
MHPMSDAPTSPDAGLNTPADLSFASLPLSAGLLATLEQLEYRSMTAIQAASLPLALAGHD
LIAQGKTGSGKTAAFGLTLLSRLDPRRLEIQALVLCPTRELSEQVTQELRRLARGEENVR
ILTLCGGSPMKPQITSLENGAHIVVGTPGRLMDHLERGSLTLAALNTLVLDEADRMLDMG
FHDAIAWVARRCPAERQTLLFSATYPPGIAELAQRFLRQPKEVKLAEQHEGSKIRQRFYE
VKHEERLQAVCTLLKHYRPASTLAFCNTKQQCRDLVQVLHGQGFSALTLNGDLEQRERDQ
VLIQFANRSCSVLVATDVAARGLDIAQLEAVINVDVTPDPEIYIHRIGRTGRGDEDGWAL
SLCSPRDRRRVETIAQMMGMELEWHTLGSLQSGNEAPLVPPMATLLLLGGRKDKLRPGDV
LGALTGEAGFAKEQVGKITVTEQVTYVAVARNIAREAVRKLAKVKGKSVKTRLLED