Protein Info for Dsui_2926 in Dechlorosoma suillum PS

Annotation: diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 PF00072: Response_reg" amino acids 9 to 122 (114 residues), 80 bits, see alignment E=1.5e-26 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 142 to 302 (161 residues), 65.1 bits, see alignment E=3.1e-22 PF00990: GGDEF" amino acids 148 to 300 (153 residues), 72.2 bits, see alignment E=4.3e-24

Best Hits

KEGG orthology group: None (inferred from 47% identity to dar:Daro_1203)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGE4 at UniProt or InterPro

Protein Sequence (388 amino acids)

>Dsui_2926 diguanylate cyclase (GGDEF) domain-containing protein (Dechlorosoma suillum PS)
MTEAPHPRILIVDDSRMVRASIIKHLKGHYEIREEGDGEAAWQTLVLDHDIQAVISDLSM
PVMDGFDLLARIRDSKVSRLRQLPVIMISGEEDEESRDKALALGANDFITKGIGTAELLA
RVDSLVRLGQAEQALHSHQDQQLRHPHSGLFTRAYLEAQAEQALSLAGRQQAPASVLVLG
FDSLERYTAQYGGALVDKLQERFAKLLAGNIRKEDSLGHYSDTTFAIVSPGTPGAASEAF
ANRLRHAVETSNIAVHGQRLPLTISIGIASFPLDGAPSATSLLAMAEARRAAAAAAGGNR
AVAPAPAVEPAAVRGGAAVSVDQALAMLAAGQDEELRPQAAALAKALMPLLSFLNYELQY
GPSADVPESKFRASGEPQGNRNPGGDAP