Protein Info for Dsui_2920 in Dechlorosoma suillum PS

Annotation: acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K01911, O-succinylbenzoic acid--CoA ligase [EC: 6.2.1.26] (inferred from 49% identity to app:CAP2UW1_1907)

Predicted SEED Role

"O-succinylbenzoic acid--CoA ligase (EC 6.2.1.26)" in subsystem Menaquinone and Phylloquinone Biosynthesis (EC 6.2.1.26)

MetaCyc Pathways

superpathway of chorismate metabolism (48/59 steps found)
superpathway of menaquinol-7 biosynthesis (8/10 steps found)
superpathway of menaquinol-8 biosynthesis I (8/10 steps found)
superpathway of demethylmenaquinol-8 biosynthesis I (7/9 steps found)
2-carboxy-1,4-naphthoquinol biosynthesis (5/7 steps found)
superpathway of menaquinol-10 biosynthesis (7/10 steps found)
superpathway of menaquinol-11 biosynthesis (7/10 steps found)
superpathway of menaquinol-12 biosynthesis (7/10 steps found)
superpathway of menaquinol-13 biosynthesis (7/10 steps found)
superpathway of menaquinol-6 biosynthesis (7/10 steps found)
superpathway of menaquinol-9 biosynthesis (7/10 steps found)
superpathway of demethylmenaquinol-6 biosynthesis I (6/9 steps found)
superpathway of demethylmenaquinol-9 biosynthesis (6/9 steps found)
superpathway of phylloquinol biosynthesis (6/15 steps found)

KEGG Metabolic Maps

Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.2.1.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGD8 at UniProt or InterPro

Protein Sequence (476 amino acids)

>Dsui_2920 acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II (Dechlorosoma suillum PS)
MNPAPFIDPHEPLDWLDPLSEDPLQLVTSDGAWRRGALVADGGALAAALLAWGASPGTIL
LAPLPAPNLARLFFACARAGIALFPLDPATSPERRAALLALAGPRGRLLEALPSAAAIAA
AADPLPPLPVAAQPALVIATSGSEGEPKGVVLTHANLAAAADASAERLPLSPGDTWLDCL
PLHHIGGVSILARCARSGATARVLDRFTVEAVAAALAAGNITHLSLVPAMLDRLLEAGVS
PGNLRYVLIGGAALSAPVFRRATTAGWPLCVSYGLSECAAQVATWVHPPPDAWQEGRVGA
PLAGCRVELDRQGRLRLAGPQVMWGYLNPELEPGRGLTDGALLSGDLARLEEDGSLTLLG
RADDMLVSGGVNVHPAEVEAVLLACPGVRDAAVTALPDPVWGDRLLALVVGDFAAMDDAG
LHRWCAERLPSPRRPRLIQRVANLPRNPMGKLQRPALRQLAQQLAQDGLLAPRETP