Protein Info for Dsui_2915 in Dechlorosoma suillum PS

Annotation: o-succinylbenzoic acid synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF21508: MenC_N
  • amino acids 7 to 79 (73 residues), 31.4 bits, E=2.6e-11
• TIGR01927: o-succinylbenzoate synthase
  • amino acids 10 to 322 (313 residues), 139.5 bits, E=7.5e-45
• PF02746: MR_MLE_N
  • amino acids 22 to 116 (95 residues), 22.1 bits, E=2.3e-08
• PF13378: MR_MLE_C
  • amino acids 143 to 348 (206 residues), 112.2 bits, E=4.4e-36

Predicted SEED Role

"O-succinylbenzoate synthase (EC 4.2.1.113)" (EC 4.2.1.113)

MetaCyc Pathways

• superpathway of chorismate metabolism (48/59 steps found)
• superpathway of menaquinol-7 biosynthesis (8/10 steps found)
• superpathway of menaquinol-8 biosynthesis I (8/10 steps found)
• superpathway of demethylmenaquinol-8 biosynthesis I (7/9 steps found)
• 2-carboxy-1,4-naphthoquinol biosynthesis (5/7 steps found)
• superpathway of menaquinol-10 biosynthesis (7/10 steps found)
• superpathway of menaquinol-11 biosynthesis (7/10 steps found)
• superpathway of menaquinol-12 biosynthesis (7/10 steps found)
• superpathway of menaquinol-13 biosynthesis (7/10 steps found)
• superpathway of menaquinol-6 biosynthesis (7/10 steps found)
• superpathway of menaquinol-9 biosynthesis (7/10 steps found)
• superpathway of demethylmenaquinol-6 biosynthesis I (6/9 steps found)
• superpathway of demethylmenaquinol-9 biosynthesis (6/9 steps found)
• superpathway of phylloquinol biosynthesis (6/15 steps found)

KEGG Metabolic Maps

• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.113

Sequence Analysis Tools

See G8QGD3 at UniProt or InterPro

Protein Sequence (354 amino acids)

>Dsui_2915 o-succinylbenzoic acid synthetase (Dechlorosoma suillum PS)
MPLRAFTFVPYRLPFRQQWRSAAGGLDQREGWLVRLEDEDGGYGYGDCAPLPGIGTEPPA
ATAAALIQWQQRFRGQEAAAALEALNDAASFDTPAARAGVESALLDLLARRNGRSLNASI
RGCDCRQRVRVNASLGSLGPHTADALDAALEAGFQVLKLKIGLAPAPQEIPLVQALCQHL
PAGSTLRLDANRAWQEGDARSWLDALAGLPIDALEEPLAQPSAPAWAALQVRAAFPLALD
ESLADLPQAALFDGTVRRLILKLPRLGGFLPAVALAQRFAAAGGDCVVTSSLESACGLLA
AAHLAAALGGDLAHGLATAEWLATDLGAPPPVAAGYLTLPAGPGLGFQPFATPA