Protein Info for Dsui_2896 in Dechlorosoma suillum PS

Annotation: outer membrane cobalamin receptor protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 746 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 52 to 69 (18 residues), see Phobius details PF07715: Plug" amino acids 101 to 214 (114 residues), 71.4 bits, see alignment E=8.6e-24 PF00593: TonB_dep_Rec_b-barrel" amino acids 240 to 720 (481 residues), 68.7 bits, see alignment E=9.1e-23

Best Hits

Predicted SEED Role

"TonB-dependent receptor; Outer membrane receptor for ferrienterochelin and colicins"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGB4 at UniProt or InterPro

Protein Sequence (746 amino acids)

>Dsui_2896 outer membrane cobalamin receptor protein (Dechlorosoma suillum PS)
MRLFDAGITVKVAATKIYNMLLSVFAANQLYRKRVWQPALVTCHRAPIMMKYLFRASILP
MFLMISALPCQGAESLADLSEQDLLADVPVVLTASRLRQNVADAPAAVTVIDRQMIRDSG
AWSIPDLFRLVPGMYVGEGADKGALVPNTMVSYHGLSDSFSRRMQVLVDGRSIYTPLFGG
AVWSTLPLALEDIERIEVIRGPNSATYGANAFLGIINIISRQAADVSGTMVSLTQSSRGN
DSTFRYGGQSGSLDYRITGSLRADQGIELQAPTAPGHSFSARRHDDKRLANLSFRGDLQL
GNRDSLEIQAGLSSGDHQSGRRESPGAYEGSPPHTRQLNSYYGSLRWQRTLSADEQLSLK
AYASRDEQNLDLSALLRDPKVTIAGLPFYLEVPYPLNSPQRLVAERYDVELQHAFAPTSS
TRLVWGGGARLDRFSSTYYLNSTEPVEFRQQNLFANLEWRPTAKWVLNAGGMLERNSFTG
TYWSPRVAANYHWQPGHTLRLIASRATHTPTIFEAKSDIRLSTSWTPASCATLKAFGLIT
SCAFPSVRSAYHQDDLRSETIDSRELGYLWELPGGHLDFKYSYDRLGDLLETYRPAGKSW
QEYRNEGNAQIRAVEMQWQQRVASNTRIHLALAASRISGFNSERSGAYAESAASHSRSML
LAHDFDHRWTGSLAYYAVGRLTVQGDGDLQTPYERVDARLAYRFRDGAYQGEVAFIVQNL
FDKPYQEVYYENLIGRRSYVNLRLEF