Protein Info for Dsui_2894 in Dechlorosoma suillum PS

Annotation: diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 722 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 182 to 202 (21 residues), see Phobius details PF09984: sCache_4" amino acids 43 to 176 (134 residues), 47.7 bits, see alignment E=3e-16 PF00672: HAMP" amino acids 203 to 255 (53 residues), 49.6 bits, see alignment 8.1e-17 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 271 to 435 (165 residues), 135.4 bits, see alignment E=7.7e-44 PF00990: GGDEF" amino acids 275 to 432 (158 residues), 134.1 bits, see alignment E=8.3e-43 PF00563: EAL" amino acids 455 to 692 (238 residues), 190.9 bits, see alignment E=4.8e-60

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGB2 at UniProt or InterPro

Protein Sequence (722 amino acids)

>Dsui_2894 diguanylate cyclase (GGDEF) domain-containing protein (Dechlorosoma suillum PS)
MMQHLYLRLVGSIRQRALWLALLPAVLVATALASYFSITGMGELDEELRRRGHTIVQYLA
PASEYGLISGNRPSLQALVQAAMQQPDVRAAVVTDFQGRVLAISGRTQLPVRLAEQAGDL
VGLLASSHDTLGFVAPVRRSQLDIDDFLSLEPMPPQPPGSDRLGWVYVELSSEDLQARKS
ALLLHTLLILTAGLGAGAYVALRMARSLSRPVGRLLKAVGRMAAGELEARVEQASAGELG
ALERGFNHMASRLQDMHESMQERIATATAQLAHQASHDPLTGLANRREFELHLQATLDGR
GGEELHHVLCYIDLDRFKVVNDTCGHAAGDELLRQITQLLRQRVRGQDLLARLGGDEFGL
LLERCSLEDGLRVVESLRQLVEDFRFVWNNRAFGIGASIGLVELDSRIQTLEEALAAADQ
ACFAAKDLGRNRIHVYQADDREVVRHQGEMDWASRLTQAVEENRLLLYAQPVVPLVSGIS
SCLRFEVFLRLLNERGEVVLPEVFLPAAERFNLMPRLDRWAIDAACSGLRRLLDQESHPS
LQCGINLSVQTVGRPETLEYIGERLQHYDIAPACLCFEVAEAAASRQFAEVQTFAQGLRQ
LGCGFAFDAFGSGLSSFAYLRALPPDYVKIDGDLIHRMTDDRVSQTLVRAIHDISRQLGV
AAVAEMVDDAAVFAMVREIGIELGQGTWFDPPQLFEDWLAVCEARHVNGEAGVYSILPSP
AA