Protein Info for Dsui_2886 in Dechlorosoma suillum PS

Annotation: intracellular septation protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 49 to 68 (20 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 121 to 139 (19 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details TIGR00997: intracellular septation protein A" amino acids 1 to 177 (177 residues), 188.3 bits, see alignment E=7e-60 PF04279: IspA" amino acids 1 to 175 (175 residues), 225.2 bits, see alignment E=3.2e-71

Best Hits

Swiss-Prot: 68% identical to YCIB_NITMU: Probable intracellular septation protein A (Nmul_A2111) from Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)

KEGG orthology group: K06190, intracellular septation protein (inferred from 70% identity to app:CAP2UW1_3308)

Predicted SEED Role

"Intracellular septation protein IspA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGA4 at UniProt or InterPro

Protein Sequence (179 amino acids)

>Dsui_2886 intracellular septation protein A (Dechlorosoma suillum PS)
MKFLFDLFPVLLFFIAFKFAGIYVATAVAIAATFGQIGWLKLRRKPVDTMLWVSLAIIVI
FGGATLVLHDETFIKWKPTVLYWMFALILGGATLFFRRNLIRSLMQEKMELPDVAWQRMN
LSWIAFFSLMGALNLYVAFHYPTETWVNFKLFGGMGLMLVFVLIQGAMLSKYVSDEEKN