Protein Info for Dsui_2885 in Dechlorosoma suillum PS

Annotation: PAS domain S-box

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1047 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 183 to 202 (20 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 258 to 385 (128 residues), 53.7 bits, see alignment E=1.1e-18 PF00989: PAS" amino acids 262 to 377 (116 residues), 50.6 bits, see alignment E=8.4e-17 PF13188: PAS_8" amino acids 262 to 308 (47 residues), 23.6 bits, see alignment (E = 1.6e-08) amino acids 393 to 457 (65 residues), 27.3 bits, see alignment 1.1e-09 PF08448: PAS_4" amino acids 268 to 382 (115 residues), 36 bits, see alignment E=3.3e-12 amino acids 399 to 516 (118 residues), 28.7 bits, see alignment E=6.2e-10 PF13426: PAS_9" amino acids 273 to 379 (107 residues), 30.2 bits, see alignment E=2.1e-10 amino acids 404 to 514 (111 residues), 16 bits, see alignment E=5.5e-06 PF00512: HisKA" amino acids 535 to 600 (66 residues), 79.2 bits, see alignment 8.9e-26 PF02518: HATPase_c" amino acids 647 to 757 (111 residues), 113.4 bits, see alignment E=3.5e-36 PF00072: Response_reg" amino acids 783 to 896 (114 residues), 91.9 bits, see alignment E=1.4e-29 PF01627: Hpt" amino acids 957 to 1038 (82 residues), 55.2 bits, see alignment 3.2e-18

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGA3 at UniProt or InterPro

Protein Sequence (1047 amino acids)

>Dsui_2885 PAS domain S-box (Dechlorosoma suillum PS)
MNQTPAVRRRFSLLPYRISSQVALLVSLLFMLTVFAFTAYTVQEQADLSQETITRHSQAL
AENIALTAAPQMVLGDESALEYFLLRSAEYPDIQALTLIDAKGKVLASVRKDAQGGSSAE
YGVSRLLPPHGEEPRSNLLETPTGRRLLLWQPVANGQVLGWLRLEIGLDLLADARRHIWQ
DSIVTALAAIIGSTTLLLLFLLRPLRALRQATDFASRLDVLRGQSLPAYHGSLEIGELVQ
ALNRASRRLKQQEETIEENSRFLQSLTDALGEGVIATDAEGRCTFINAEGERMLGWRRQE
LLGKDVHHTIHFQTATGFHVSQDECPLHSPAVASRPFRSELDAFTRSDGSVFPISVVSVP
LFEGERFTGTVAAFQDITERKRDEDFLMATTSRLSALIESMQAGILVEDENRQIVLANQA
LGQLFELDVDPQELVGVDCRLVLQHLQGLCADGARFVPRVEAVVEDRRAVLGEEIRLADG
RVLERDYIPIYLFPQVAQPEDYRGHLWLFRDITERKHAELELQQAKEAAESANRAKGEFL
ANMSHEIRTPMNGILGMTDLALDSALTPEQRDYLEMVKSSADALLVIINDILDFSKIEAG
KLELEHIHFHLRQLLRETLKPLELRARQRSLTLRCEVPEEVADGYLGDPGRLRQVLINLV
GNAIKFTEEGQVAVRVEARDGLLHFAVSDTGIGIPADKQQLIFEAFSQADSSVTRRFGGT
GLGLTICTRLVRLMGGHMWVESDPGQGSTFHFTARLEAVAGPAESGEADAGRGEVVLPPL
RLLVAEDNPVNQKLVLTLLQKRGHRVTLADNGQQALAALATDHFDLVLMDMQMPVMGGLE
ATRRIRAAEAARGDGQHLPIVAMTANAMAGDRELCLEAGMDGYVSKPLRRDEFFSAMADV
LPPERLRQAGAAAAIPADGQAAVAAAPSESAPAALRRCDRAEAVARLEGDEELFAMLVKM
FSDDLPNYLQRLNAALAGQDMEALSREAHTLKGLLATFSAGRGTALALELETRAKGGHVE
TLGVLVRQLQEELELVRQELLAGAPAA