Protein Info for Dsui_2875 in Dechlorosoma suillum PS

Annotation: outer membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 491 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF02321: OEP" amino acids 73 to 254 (182 residues), 110.4 bits, see alignment E=4.5e-36 amino acids 283 to 461 (179 residues), 106.9 bits, see alignment E=5.5e-35

Best Hits

KEGG orthology group: K03287, outer membrane factor, OMF family (inferred from 58% identity to dar:Daro_1165)

Predicted SEED Role

"Type I secretion system, outer membrane component LapE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QG93 at UniProt or InterPro

Protein Sequence (491 amino acids)

>Dsui_2875 outer membrane protein (Dechlorosoma suillum PS)
MPVTAPARSAFAPLPLTLAFAAVLAAAPALALDPLGSDALAPPRPALGGSEGQGANPCPE
QPVSGALSLTEVVERALCHNPQTREVWANARAQAALVGVAQAAYLPGLSLSAGQSRNRND
SRKPESYTQKNAGLTLSYLLFDFGARAATLENARQLLAAAAATQDSTVQAVFLAALQAYY
QVQATEAALVAARESERASLESFNAADARYKVGTATPADRLQAQTAYSQASLKRIQADRD
FKNAQGTLANVIGGEAHRPPALVPATPVVAPTREFTADVDALVAEARRRRPDLVAAEAQY
QAAQANVEAARAAGLPTLSLTAGPAYQDLGGNVSNTSSIGVTLNVPLFTGFSTTYKVRNA
ESLKEAREAQRERIRQQVALDVWKAYQGLITAGQSLQTTADLLVSAEAAEKVALGRYKAG
LGSILDVLNAQSALAAARQQRVQATFEWNVSRATLAQSMGNLDISLLQSLPDAATANAGQ
SAASGSIQGSN