Protein Info for Dsui_2866 in Dechlorosoma suillum PS

Annotation: outer membrane receptor for ferrienterochelin and colicins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF07715: Plug" amino acids 65 to 173 (109 residues), 81.3 bits, see alignment E=7.1e-27 PF00593: TonB_dep_Rec_b-barrel" amino acids 202 to 618 (417 residues), 103.7 bits, see alignment E=2.2e-33

Best Hits

Predicted SEED Role

"TonB-dependent receptor; Outer membrane receptor for ferrienterochelin and colicins"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFT9 at UniProt or InterPro

Protein Sequence (650 amino acids)

>Dsui_2866 outer membrane receptor for ferrienterochelin and colicins (Dechlorosoma suillum PS)
MPFKARLSALLALASCSAACLLQEPARAAGDEPVAAELASLSTLSIEELLRTEVSSVLKH
PSELAQAPAATTVLRREDIQRLGATTLPDLLRTVPGLHVAQIDGNKWGVSARGFNGFFGG
KLLVLIDGRSIYNSIYSGVFWDAYDIALDDIARIEVVRGPGAALWGANAVNGVINIVTRS
AHETQGGQATLAVGNVERGMANVRWGSTTEEGGAWRLYARSRSRDDHQSLTGSGAGDTWR
ADRIGFRADSAAGSDTWMVNGEAYQGHSGGAPYPLSTANDISGQHLLGRLSRRLGDGSQL
QVQSYVDHSWRREPSSGSVLEETVADVDLQHTVNLSPAHRLVWGGGWRQYRFDSVSSAKL
SFSPVSSQRTVTNLFVQDEWTVIPETLQIIAGAKLERVPDHGSEWQPNLRAVWNAAAGHT
LWAGTARAVRSPNQVDTAIRFNGPGVGPLPAVGNPAFRPERLRSLEAGWRAQLTPNLSSD
VSVYQNHYKDLQTIEFDGASSMMYFNNAQGRTRGLEWALDWQAAAHWQLRGGFTLYREAL
DYSSRPVGPALISFQGGFPREQLFIRSLWDLSRNQRLDLTWRGVGPMDQRGVAGYGTFDL
RWTQRLDRRSEVSLIGRNLLGPKHREFGDQPFFQETVLRRELSVVLSWGF