Protein Info for Dsui_2857 in Dechlorosoma suillum PS

Annotation: lipoprotein releasing system, ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details TIGR02211: lipoprotein releasing system, ATP-binding protein" amino acids 26 to 244 (219 residues), 322.9 bits, see alignment E=4.6e-101 PF00005: ABC_tran" amino acids 46 to 194 (149 residues), 115.8 bits, see alignment E=2.4e-37

Best Hits

Swiss-Prot: 69% identical to LOLD_NITEU: Lipoprotein-releasing system ATP-binding protein LolD (lolD) from Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)

KEGG orthology group: K09810, lipoprotein-releasing system ATP-binding protein [EC: 3.6.3.-] (inferred from 70% identity to app:CAP2UW1_1042)

MetaCyc: 58% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"Lipoprotein releasing system ATP-binding protein LolD"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFT0 at UniProt or InterPro

Protein Sequence (249 amino acids)

>Dsui_2857 lipoprotein releasing system, ATP-binding protein (Dechlorosoma suillum PS)
MNEAAMASAAAVAESAMENRASDTAVLACQGLSKVYRQGDLEVPVLTRIDLSLQPGERLA
VVGSSGSGKSTLLHLLGGLDRPTAGTVRLKGADPFSLSEAARGEWRNRYLGFVYQFHHLL
AEFTALENVAMPLLIRRLPRAEAESQAEAMLQKVGLGHRLHHLPSELSGGERQRAAIARA
LVTRPACVLADEPTGNLDRHTAEQVFDLMLEVSREQGTAFVIVTHDPALAARADRTVHLA
DGMFLEEPW