Protein Info for Dsui_2823 in Dechlorosoma suillum PS

Annotation: DNA internalization-related competence protein ComEC/Rec2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 577 transmembrane" amino acids 24 to 40 (17 residues), see Phobius details amino acids 47 to 66 (20 residues), see Phobius details amino acids 106 to 125 (20 residues), see Phobius details amino acids 248 to 271 (24 residues), see Phobius details amino acids 286 to 325 (40 residues), see Phobius details amino acids 327 to 343 (17 residues), see Phobius details amino acids 347 to 347 (1 residues), see Phobius details amino acids 349 to 371 (23 residues), see Phobius details amino acids 392 to 410 (19 residues), see Phobius details amino acids 421 to 441 (21 residues), see Phobius details amino acids 452 to 472 (21 residues), see Phobius details amino acids 478 to 498 (21 residues), see Phobius details PF13567: DUF4131" amino acids 20 to 179 (160 residues), 118.6 bits, see alignment E=2.4e-38 TIGR00361: DNA internalization-related competence protein ComEC/Rec2" amino acids 138 to 563 (426 residues), 202.7 bits, see alignment E=8.7e-64 PF03772: Competence" amino acids 224 to 494 (271 residues), 199.5 bits, see alignment E=7.1e-63 TIGR00360: ComEC/Rec2-related protein" amino acids 245 to 433 (189 residues), 93.7 bits, see alignment E=1.6e-30

Best Hits

Predicted SEED Role

"DNA internalization-related competence protein ComEC/Rec2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFP9 at UniProt or InterPro

Protein Sequence (577 amino acids)

>Dsui_2823 DNA internalization-related competence protein ComEC/Rec2 (Dechlorosoma suillum PS)
MNWPLYSFALGIVLLQQQPALPPWPWLPLGAAATLGLLALGRRPGALPRLGTILLAAALG
FLWAGWRAETRLAERLAPALEGLDLQLQGRIAALPQDFGRGQRFEFAVAPGAGVSLPPTL
LLSWYDRPETPRPRLEPGQKWQLTVRLKRPHGHANGAGFDYEAWLLERGIGATGYVREAG
DNRLLGRSDGFFSRIERLRQAVREDFQARLPEADYPYAGILTALAVGDQKAIPGDQWKVF
AGTGTTHLMSISGLHVTMMAALAAALAGALWRRSPTLMARWPAQRAALLAGWLAAAGYTL
LAGAGVPALRTLAMLGAAALALASGRRVAPGNVLAFALLAVLLPDPWAVLAPGFWLSFVA
VGALLLAARPLAEEPPRQSWRRLGRHLGHWSLTQWVATLGTLPLLLLFFQQFSLVSPLAN
ALAIPLVSLAVTPLALAAALLPLPGLAAAAHALLHGLMLCLQWLAALPGALWTPPAPTLP
ALFLAALGCVCVLLPRGFPGRWLGLLMLLPLLATPQPRPPPGQAWVTLLDVGQGLAVAVR
TQKHTLLYDAGPYYSPESDAGERVPRSITVPIWNGYT