Protein Info for Dsui_2820 in Dechlorosoma suillum PS

Annotation: putative hydrolase or acyltransferase of alpha/beta superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 PF12146: Hydrolase_4" amino acids 47 to 284 (238 residues), 46 bits, see alignment E=6.5e-16 PF00561: Abhydrolase_1" amino acids 48 to 288 (241 residues), 82.3 bits, see alignment E=6.7e-27 PF12697: Abhydrolase_6" amino acids 49 to 292 (244 residues), 81 bits, see alignment E=3.1e-26

Best Hits

KEGG orthology group: None (inferred from 68% identity to tmz:Tmz1t_1991)

Predicted SEED Role

"probable hydrolase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFP6 at UniProt or InterPro

Protein Sequence (301 amino acids)

>Dsui_2820 putative hydrolase or acyltransferase of alpha/beta superfamily (Dechlorosoma suillum PS)
MNICNSLRRLFSPAPAMVEKRVLCAALDGSGLHRMAYTQWGDPANPRVLVCVHGLTRNGR
DFDFLARQLSRHYRVVCPDVVGRGRSDWLKKASGYGFPQYVADMVSLIARLDVAEVHWLG
TSMGGLIGMCIAAMERSPITRLILNDVGPVITNESLRRIGEYVGKAPRFPSLEAAEQFIR
QVSAPFGSLTDAQWRHLTETSVRQADDGQWEMRYDPAIAEAFQLGFVMHQDVILWPYYDA
IRCPTLVIRGAESDLLPREALAEMARRGPQAWTREIPGVGHAPMFQDPAQVAVVREFLLG
A